-20%
VIP Nasal Spray - Image 1

VIP Nasal Spray

Original price was: $243.00.Current price is: $195.00.

Peak Lab Purity Guarantee

Member Price: $156.00 Become a member →
✓ ...
✓ 99%+ purity guaranteed
✓ USA Lab Verified

Become a Member and save 20% on Every Order. 

Become a Member

Monthly Membership
Yearly Membership
Lifetime Membership
EMAIL US FOR WHOLESALE PRICING
Orders of $5,000 or more

Description

VIP (Vasoactive Intestinal Peptide) – 10mg (Lyophilized Peptide in 3ml Vial) – For Research Use Only

VIP (Vasoactive Intestinal Peptide) is a naturally occurring neuropeptide and immunomodulator studied for its effects on vasodilation, smooth muscle relaxation, immune regulation, and neuroprotection. It plays a crucial role in gastrointestinal, pulmonary, and central nervous system signaling.

In research models, VIP has shown promise in areas such as inflammatory and autoimmune disease, lung function, and gut-brain axis modulation.

Product Details:

Peptide: VIP (Vasoactive Intestinal Peptide)

Purity: >98%

Form: Lyophilized powder

Quantity: 10mg per vial

Vial Size: 3ml sterile glass vial

Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

Neuroprotection and brain-gut axis studies

Pulmonary function and airway inflammation models

Immune system modulation and anti-inflammatory research

Gastrointestinal motility and secretory regulation

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease

Description

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.

VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.

Overview
  • Peptide Name: Vasoactive Intestinal Peptide (VIP)
  • Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
  • Length: 28 amino acids
  • Molecular Weight: ~3,327 Da
  • Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
  • Purity: ≥98% (HPLC verified)
  • Format: Lyophilized powder, 10mg vial

Use: For laboratory research only, not for clinical or diagnostic use

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “VIP Nasal Spray”

Your email address will not be published. Required fields are marked *

Research

1. Neuroimmune Signaling and Inflammatory Regulation

VIP is used to study cytokine modulation in immune cells including T lymphocytes, macrophages, and dendritic cells. It is involved in downregulating pro-inflammatory mediators (e.g., TNF-α, IL-6) and upregulating anti-inflammatory cytokines like IL-10 in in-vitro and animal models.

2. Vascular and Smooth Muscle Physiology

Through VPAC1/VPAC2 activation, VIP induces relaxation in smooth muscle tissues such as airway, vascular, and gastrointestinal smooth muscle. These properties are often evaluated in cardiovascular or pulmonary research for assessing vasodilatory and bronchodilatory mechanisms.

3. Epithelial Barrier Integrity

VIP has been studied in gut and respiratory epithelial models where it enhances tight-junction protein expression, aiding in barrier maintenance and regulating permeability. This is relevant in preclinical studies on inflammatory bowel disease (IBD) and respiratory epithelial dysfunction.

4. Neuroprotective and Synaptic Maintenance Studies

VIP has been shown to support neurotrophic factor expression and synaptic homeostasis. It is used in neurodegenerative models and CNS-focused research to evaluate neuroplasticity, synapse maintenance, and neuron-glia signaling.

5. Anti-Fibrotic Pathway Exploration

Preclinical studies indicate that VIP downregulates fibrotic markers in lung and cardiac models, making it useful in research investigating peptide-regulated fibrotic and remodeling processes in chronic disease contexts.

FAQ 

Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.

Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.

Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.

Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.

Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.

Shipping & Delivery

Storage & Handling

All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.

  • On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
  • Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
  • After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.

Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.

Peak Lab Peptides maintains quality-control processes and routinely performs third-party testing to support purity and identity verification. COAs are available upon request for applicable batches. Documentation may vary depending on production timelines.

We aim to make batch-level documentation available whenever possible. Our goal is to expand COA access across the full catalog as production capacity grows.

All products are for laboratory research use only and are not intended for human consumption.

Related Products

-20%

B12 (1ml / 1mg)

, , , , , ,
Original price was: $38.00.Current price is: $30.40.

Vitamin B12 (Cyanocobalamin)

Vitamin B12 (Cyanocobalamin) – 1mg / 1ml – For Research Use Only Vitamin B12 (Cyanocobalamin) is a water-soluble vitamin essential for red blood cell formation, neurological function, and DNA synthesis. In research settings, it is studied for its role in energy metabolism, nerve repair, and cognitive support.

Product Details:

Compound: Cyanocobalamin (Vitamin B12) Concentration: 1mg / 1ml per vial Form: Sterile injectable solution Container: 3ml / 10ml multi-dose vial Storage: Store in a cool, dry place. Refrigerate after opening. Research Grade: For laboratory research purposes only. Not for human consumption or therapeutic use. Research Applications May Include: Studies on energy metabolism and fatigue Neurological repair and neuroprotection research Red blood cell production models
Add to cart
-20%
Cerebroprotein Hydrolysate

Cerebroprotein Hydrolysate 60mg

,
Original price was: $105.00.Current price is: $84.00.

Cerebrolysin

Cerebroprotein Hydrolysate– 60mg (Lyophilized Peptide) – For Research Use Only

Cerebroprotein Hydrolysate is a unique neuropeptide preparation composed of low molecular weight peptides and amino acids. It is widely studied for its potential neuroprotective, neurotrophic, and cognitive-enhancing properties. Research models have focused on its role in supporting neuronal survival, synaptic plasticity, and brain repair mechanisms.

Cerebrolysin is of particular interest in studies related to brain injury, neurodegeneration, and cognitive decline.

Product Details:

  • Compound: Cerebroprotein Hydrolysate

  • Purity: Research-grade peptide complex

  • Form: Lyophilized powder

  • Quantity: 60mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For laboratory research only. Not for human consumption or therapeutic use.

Potential Research Applications:

  • Neuroprotection and brain injury models

  • Cognitive function and memory research

  • Studies on neurodegenerative conditions

  • Synaptic plasticity and neural repair exploration

Add to cart
-20%

CJC-1295 with DAC Nasal Spray

, ,
Original price was: $177.00.Current price is: $141.60.

CJC-1295 with DAC

CJC-1295 with DAC – 5mg (Lyophilized Peptide) – For Research Use Only

CJC-1295 with DAC (Drug Affinity Complex) is a long-acting analog of Growth Hormone-Releasing Hormone (GHRH), designed to promote sustained release of growth hormone (GH) in research models. The DAC modification significantly extends its half-life, allowing for prolonged activity and making it ideal for studies on muscle growth, recovery, anti-aging, and fat metabolism.

CJC-1295 with DAC is often paired in research with peptides like Ipamorelin for synergistic GH axis stimulation.

Product Details:

  • Peptide: CJC-1295 with DAC

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 5mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Sustained growth hormone release studies

  • Muscle growth, recovery, and anti-aging research models

  • Fat metabolism and body composition investigations

  • Long-acting GHRH analog research

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

Add to cart
-20%
DSIP

DSIP

, ,
Price range: $31.20 through $50.40

DSIP (Delta Sleep-Inducing Peptide)

DSIP (Delta Sleep-Inducing Peptide) – 5mg (Lyophilized Powder) – For Research Use Only

DSIP is a naturally occurring neuropeptide studied for its potential role in sleep regulation, stress response, and neuroendocrine function. Originally isolated from the brain, DSIP is of particular interest in research on sleep patterns, circadian rhythm modulation, and stress adaptation mechanisms.

Studies have also explored its potential influence on hormone release, oxidative stress, and neuroprotection.

Product Details:

  • Peptide: DSIP (Delta Sleep-Inducing Peptide)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 5mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Sleep regulation and circadian rhythm studies

  • Stress adaptation and cortisol modulation research

  • Neuroprotection and oxidative stress models

  • Endocrine system and hormone balance investigations

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Select options This product has multiple variants. The options may be chosen on the product page
-17%Hot

Ipamorelin Nasal Spray

, ,
Original price was: $126.00.Current price is: $105.00.

Ipamorelin

Ipamorelin – 5mg (Lyophilized Peptide) – For Research Use Only

Ipamorelin is a selective Growth Hormone Secretagogue (GHS) studied for its ability to stimulate natural growth hormone (GH) release without significantly affecting cortisol or prolactin levels. Known for its clean safety profile in research models, Ipamorelin is commonly explored in studies on muscle growth, recovery, fat metabolism, and anti-aging.

Ipamorelin is often paired in research with other GH-releasing peptides like CJC-1295 No DAC for synergistic effects.

Product Details:

  • Peptide: Ipamorelin

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 5mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Growth hormone secretion and endocrine studies

  • Muscle growth, recovery, and anti-aging research models

  • Fat metabolism and body composition studies

  • GH axis and pituitary function investigations

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Add to cart
-20%

MOTS-c Nasal Spray

, , ,
Original price was: $444.00.Current price is: $354.00.

MOTS-c

MOTS-c – 10mg (Lyophilized Peptide) – For Research Use Only

MOTS-c is a mitochondrial-derived peptide (MDP) encoded by the mitochondrial genome, widely studied for its potential role in metabolic regulation, energy homeostasis, and cellular protection. Research has focused on its ability to influence glucose metabolism, insulin sensitivity, and mitochondrial function, making it a key subject in studies on metabolic health and aging.

MOTS-c is of special interest in research exploring exercise mimetic effects, fat metabolism, and metabolic syndrome models.

Product Details:

  • Peptide: MOTS-c (Mitochondrial Open Reading Frame of the 12S rRNA-c)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 10mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption or therapeutic applications.

Potential Research Applications:

  • Glucose metabolism and insulin sensitivity studies

  • Mitochondrial function and energy regulation research

  • Aging, longevity, and metabolic health models

  • Exercise mimetic and fat metabolism investigations

For laboratory research use only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Add to cart
-20%
Melanotan 2

MT-2 (Melanotan 2) – 10mg

,
Original price was: $55.00.Current price is: $44.00.

Melanotan II (MT-2)

MT-2 (Melanotan 2) – 10mg (Lyophilized Peptide) – For Research Use Only

Melanotan 2 (MT-2) is a synthetic analog of the alpha-melanocyte-stimulating hormone (α-MSH), studied for its ability to activate melanocortin receptors involved in skin pigmentation, appetite regulation, and sexual function.
Research has focused on MT-2’s effects on melanin production, UV protection, libido, and energy balance in laboratory models.

Product Details:

  • Peptide: Melanotan 2 (MT-2)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 10mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Melanogenesis and skin pigmentation studies

  • UV protection and tanning research models

  • Libido and sexual function investigations

  • Energy regulation and melanocortin receptor research

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Add to cart
-21%
NAD+ Peptide

NAD+

,
Price range: $23.00 through $52.00

NAD+ (Nicotinamide Adenine Dinucleotide)

NAD+ (Nicotinamide Adenine Dinucleotide) – 500mg (Lyophilized Powder) – For Research Use Only

NAD+ is a vital coenzyme found in all living cells, playing a critical role in energy metabolism, mitochondrial function, and cellular repair. It is heavily studied in research models exploring aging, metabolic health, oxidative stress, and neuroprotection.

NAD+ is particularly significant in studies on sirtuin activation, DNA repair pathways, and mitochondrial health, making it a key component of advanced longevity and metabolic research.

Product Details:

  • Compound: NAD+ (Nicotinamide Adenine Dinucleotide)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 500mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Mitochondrial function and energy metabolism studies

  • Anti-aging, longevity, and sirtuin pathway research

  • DNA repair and oxidative stress models

  • Neuroprotection and cognitive function investigations

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Select options This product has multiple variants. The options may be chosen on the product page
-21%

Selank 10/11mg

,
Original price was: $43.00.Current price is: $34.00.

Selank

Selank – 11mg (Lyophilized Peptide) – For Research Use Only

Selank is a synthetic peptide analog of the naturally occurring tetrapeptide Tuftsin, extensively studied for its potential nootropic, anxiolytic, and immunomodulatory properties. Research suggests that Selank may support cognitive function, anxiety reduction, and immune system regulation through its interaction with neurotransmitter systems, particularly GABA and serotonin pathways.

Product Details:

  • Peptide: Selank (Tuftsin analog)

  • Purity: >98%

  • Form: Lyophilized powder

  • Quantity: 11mg per vial

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

  • Nootropic and cognitive function studies

  • Anxiolytic and mood regulation research

  • Immune modulation and cytokine balance exploration

  • Neurotransmitter activity and brain health models

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.

THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Add to cart
-21%

Semax

,
Price range: $27.00 through $34.00

Semax

Semax – 5mg or 11mg (Lyophilized Peptide) – For Research Use Only Semax is a synthetic peptide derivative of adrenocorticotropic hormone (ACTH 4-10) that has been extensively studied for its potential neuroprotective and cognitive-enhancing effects. Originally developed in Russia, Semax is believed to modulate brain-derived neurotrophic factor (BDNF) and influence neurotransmitter systems.

Product Details:

Compound: Semax Purity: >98% Form: Lyophilized powder Quantity: 5mg or 11mg per vial Storage: Store lyophilized at -20°C. Reconstituted product should be refrigerated (2–8°C) and used within 30 days. Research Grade: For laboratory research only. Not for human consumption or therapeutic use. Research Applications May Include: Studies on neuroprotection and cognitive function Exploration of BDNF modulation Investigations into stroke recovery and brain injury models
THIS IS NOT FOR HUMAN CONSUMPTION. SOLD FOR RESEARCH ONLY!
Select options This product has multiple variants. The options may be chosen on the product page