VIP
Original price was: $81.00.$65.00Current price is: $65.00.
Become a Member and save 20% on Every Order.
Description
VIP (Vasoactive Intestinal Peptide) – 10mg (Lyophilized Peptide in 3ml Vial) – For Research Use Only
VIP (Vasoactive Intestinal Peptide) is a naturally occurring neuropeptide and immunomodulator studied for its effects on vasodilation, smooth muscle relaxation, immune regulation, and neuroprotection. It plays a crucial role in gastrointestinal, pulmonary, and central nervous system signaling.
In research models, VIP has shown promise in areas such as inflammatory and autoimmune disease, lung function, and gut-brain axis modulation.
Product Details:
Peptide: VIP (Vasoactive Intestinal Peptide)
Purity: >98%
Form: Lyophilized powder
Quantity: 10mg per vial
Vial Size: 3ml sterile glass vial
Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.
Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.
Potential Research Applications:
Neuroprotection and brain-gut axis studies
Pulmonary function and airway inflammation models
Immune system modulation and anti-inflammatory research
Gastrointestinal motility and secretory regulation
For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease
VIP Peptide Research Details
VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.
VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.
About VIP Peptide
- Peptide Name: Vasoactive Intestinal Peptide (VIP)
- Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
- Length: 28 amino acids
- Molecular Weight: ~3,327 Da
- Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
- Purity: ≥98% (HPLC verified)
- Format: Lyophilized powder, 10mg vial
Use: For laboratory research only, not for clinical or diagnostic use
5 reviews for VIP
VIP Peptide Scientific Research
1. Neuroimmune Signaling and Inflammatory Regulation
VIP is used to study cytokine modulation in immune cells including T lymphocytes, macrophages, and dendritic cells. It is involved in downregulating pro-inflammatory mediators (e.g., TNF-α, IL-6) and upregulating anti-inflammatory cytokines like IL-10 in in-vitro and animal models.
2. Vascular and Smooth Muscle Physiology
Through VPAC1/VPAC2 activation, VIP induces relaxation in smooth muscle tissues such as airway, vascular, and gastrointestinal smooth muscle. These properties are often evaluated in cardiovascular or pulmonary research for assessing vasodilatory and bronchodilatory mechanisms.
3. Epithelial Barrier Integrity
VIP has been studied in gut and respiratory epithelial models where it enhances tight-junction protein expression, aiding in barrier maintenance and regulating permeability. This is relevant in preclinical studies on inflammatory bowel disease (IBD) and respiratory epithelial dysfunction.
4. Neuroprotective and Synaptic Maintenance Studies
VIP has been shown to support neurotrophic factor expression and synaptic homeostasis. It is used in neurodegenerative models and CNS-focused research to evaluate neuroplasticity, synapse maintenance, and neuron-glia signaling.
5. Anti-Fibrotic Pathway Exploration
Preclinical studies indicate that VIP downregulates fibrotic markers in lung and cardiac models, making it useful in research investigating peptide-regulated fibrotic and remodeling processes in chronic disease contexts.
VIP Peptide FAQ
Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.
Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.
Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.
Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.
Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.
Storage & Handling
All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.
- On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
- Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
- After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.
Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.
Peak Lab Peptides maintains quality-control processes and routinely performs third-party testing to support purity and identity verification. COAs are available upon request for applicable batches. Documentation may vary depending on production timelines.
We aim to make batch-level documentation available whenever possible. Our goal is to expand COA access across the full catalog as production capacity grows.
All products are for laboratory research use only and are not intended for human consumption.
Related Products
Acetic Acid 0.6%
Acetic Acid 0.6% – 10ml (Sterile Solution) – For Laboratory Use Only
Acetic Acid 0.6% is a sterile, aqueous solution commonly used in research and lab settings for pH adjustment, buffer preparation, and preservative applications. Its mild acidic properties make it suitable for studies involving topical antimicrobial effects, cellular environment modification, and reagent preparation. This solution is intended for controlled research environments requiring low-concentration acetic acid in a sterile, injectable-grade format.Product Details:
Compound: Acetic Acid 0.6% in sterile water Volume: 10ml multi-dose vial Form: Sterile solution Concentration: 0.6% w/v Storage: Store at 68–77°F (20–25°C); protect from light and contamination Grade: For laboratory research only. Not for human or animal use in therapeutic or diagnostic procedures.Potential Research Applications:
pH regulation and buffer system studies Topical antimicrobial and cytotoxicity research Reagent dilution and formulation preparation Laboratory protocol requiring acidic conditions For laboratory use only. This product is not intended to diagnose, treat, cure, or prevent any disease.
KLOW Blend 80mg – GHK-Cu, TB-500, BPC-157, KPV
KLOW – 80mg Peptide Blend (Lyophilized Powder) – For Research Use Only GHK-Cu • TB-500 • BPC-157 • KPV
KLOW is an advanced 4-in-1 research peptide blend combining 80mg of regenerative and anti-inflammatory compounds studied for their potential in tissue repair, immune modulation, and cellular recovery. Designed for comprehensive healing models, KLOW offers synergistic support across skin, muscle, and gut research applications. Active Ingredients (Per Vial): GHK-Cu – 50mg Studied for skin regeneration, wound healing, collagen stimulation, and hair follicle support. TB-500 – 10mg A fragment of Thymosin Beta-4, known for supporting angiogenesis, cell migration, and muscle recovery. BPC-157 – 10mg Derived from a gastric protein, BPC-157 is studied for gut repair, tendon/ligament healing, and anti-inflammatory effects. KPV – 10mg A tripeptide fragment with strong research interest for localized inflammation and immune modulation, particularly in the gut and skin. Product Details: Total Peptide Content: 80mg per vial: Lyophilized powder Purity: >98% Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days. Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use. Potential Research Applications: Soft tissue, muscle, and ligament repair Skin rejuvenation and wound healing models Inflammatory bowel and gut barrier integrity studies Anti-inflammatory and immune modulation research For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease.
LL-37 (5mg)
LL-37 – 5mg (Lyophilized Peptide in 3ml Vial) – For Research Use Only
LL-37 is a human antimicrobial peptide derived from the cathelicidin family, extensively studied for its roles in innate immunity, antimicrobial defense, wound healing, and inflammation regulation. LL-37 exhibits broad-spectrum activity against bacteria, viruses, and fungi, and plays a key role in modulating the body’s immune and inflammatory responses. In research, LL-37 is of particular interest in models exploring skin healing, immune signaling, tissue regeneration, and antimicrobial resistance.Product Details:
Peptide: LL-37 Purity: >98% Form: Lyophilized powder Quantity: 5mg per vial Vial Size: 3ml sterile glass vial Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days. Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.Potential Research Applications:
Antimicrobial and infection control models Wound healing and skin regeneration studies Immune system modulation and inflammation research Studies on epithelial repair and barrier function For laboratory research use only. This product is not intended to diagnose, treat, cure, or prevent any disease.
Peptide Storage Case (3ml x 5 + Multi-Compartment) — Hard Shell Complete Organizer
An all-in-one solution for organizing your full research workflow.
This hard shell peptide storage case is designed to securely hold up to 5 standard 3ml vials, with additional dedicated compartments for other essential research materials. The precision-fit interior keeps every component stable and separated, so your full setup stays organized in a single case.
Built with a lightweight, impact-resistant shell and secure snap latches, this case is freezer and refrigerator safe — making it a reliable option for both at-home storage and on-the-go use.
Key Features:
- Custom-fit layout: Holds 5 × 3ml vials plus dedicated storage for essential research supplies
- Hard shell exterior: Durable, impact-resistant protection
- Secure snap latches: Keeps contents safely contained
- Precision interior compartments: Minimize movement and vibration
- Freezer & refrigerator safe: Maintains integrity in cold storage
- Compact dimensions: 6.75"W × 4"D × 2.25"H
- Travel-friendly: Lightweight and easy to transport
The most complete option in our storage lineup, built for researchers who want everything organized in one place.
Important:
- For research use only. Not for human consumption.
- Vials and supplies not included
Timothy –
Consistent quality keeps me coming back.
Jonathan –
No complaints so far—every order has gone smoothly.
Melissa –
A great balance between price, quality, and service.
Benjamin –
Delivery timelines have always been accurate and dependable.
Rebecca –
The store has earned my trust through consistency.