(5 customer reviews)

VIP

Original price was: $81.00.Current price is: $65.00.

Member Price: $52.00 Become a member →
VIP Peptide
This item: VIP
Original price was: $81.00.Current price is: $65.00.
Original price was: $81.00.Current price is: $65.00.
Research Spray Kit
1 × Research Spray Kit

In stock

Original price was: $35.00.Current price is: $28.00.
...
99%+ purity guaranteed
USA Lab Verified

Become a Member and save 20% on Every Order. 

Become a Member

EMAIL US FOR WHOLESALE PRICING
Orders of $5,000 or more

Description

VIP (Vasoactive Intestinal Peptide) – 10mg (Lyophilized Peptide in 3ml Vial) – For Research Use Only

VIP (Vasoactive Intestinal Peptide) is a naturally occurring neuropeptide and immunomodulator studied for its effects on vasodilation, smooth muscle relaxation, immune regulation, and neuroprotection. It plays a crucial role in gastrointestinal, pulmonary, and central nervous system signaling.

In research models, VIP has shown promise in areas such as inflammatory and autoimmune disease, lung function, and gut-brain axis modulation.

Product Details:

Peptide: VIP (Vasoactive Intestinal Peptide)

Purity: >98%

Form: Lyophilized powder

Quantity: 10mg per vial

Vial Size: 3ml sterile glass vial

Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.

Potential Research Applications:

Neuroprotection and brain-gut axis studies

Pulmonary function and airway inflammation models

Immune system modulation and anti-inflammatory research

Gastrointestinal motility and secretory regulation

For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease

Description

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.

VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.

Overview
  • Peptide Name: Vasoactive Intestinal Peptide (VIP)
  • Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
  • Length: 28 amino acids
  • Molecular Weight: ~3,327 Da
  • Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
  • Purity: ≥98% (HPLC verified)
  • Format: Lyophilized powder, 10mg vial

Use: For laboratory research only, not for clinical or diagnostic use

Reviews (5)

5 reviews for VIP

  1. Timothy

    Consistent quality keeps me coming back.

  2. Jonathan

    No complaints so far—every order has gone smoothly.

  3. Melissa

    A great balance between price, quality, and service.

  4. Benjamin

    Delivery timelines have always been accurate and dependable.

  5. Rebecca

    The store has earned my trust through consistency.

Add a review

Your email address will not be published. Required fields are marked *

Research

1. Neuroimmune Signaling and Inflammatory Regulation

VIP is used to study cytokine modulation in immune cells including T lymphocytes, macrophages, and dendritic cells. It is involved in downregulating pro-inflammatory mediators (e.g., TNF-α, IL-6) and upregulating anti-inflammatory cytokines like IL-10 in in-vitro and animal models.

2. Vascular and Smooth Muscle Physiology

Through VPAC1/VPAC2 activation, VIP induces relaxation in smooth muscle tissues such as airway, vascular, and gastrointestinal smooth muscle. These properties are often evaluated in cardiovascular or pulmonary research for assessing vasodilatory and bronchodilatory mechanisms.

3. Epithelial Barrier Integrity

VIP has been studied in gut and respiratory epithelial models where it enhances tight-junction protein expression, aiding in barrier maintenance and regulating permeability. This is relevant in preclinical studies on inflammatory bowel disease (IBD) and respiratory epithelial dysfunction.

4. Neuroprotective and Synaptic Maintenance Studies

VIP has been shown to support neurotrophic factor expression and synaptic homeostasis. It is used in neurodegenerative models and CNS-focused research to evaluate neuroplasticity, synapse maintenance, and neuron-glia signaling.

5. Anti-Fibrotic Pathway Exploration

Preclinical studies indicate that VIP downregulates fibrotic markers in lung and cardiac models, making it useful in research investigating peptide-regulated fibrotic and remodeling processes in chronic disease contexts.

FAQ 

Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.

Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.

Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.

Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.

Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.

Shipping & Delivery

Storage & Handling

All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.

  • On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
  • Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
  • After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.

Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.

Peak Lab Peptides maintains quality-control processes and routinely performs third-party testing to support purity and identity verification. COAs are available upon request for applicable batches. Documentation may vary depending on production timelines.

We aim to make batch-level documentation available whenever possible. Our goal is to expand COA access across the full catalog as production capacity grows.

All products are for laboratory research use only and are not intended for human consumption.