VIP
Price range: $46.96 through $61.60
Become a Member and save 20% on Every Order.
Description
VIP (Vasoactive Intestinal Peptide) – 10mg (Lyophilized Peptide in 3ml Vial) – For Research Use Only
VIP (Vasoactive Intestinal Peptide) is a naturally occurring neuropeptide and immunomodulator studied for its effects on vasodilation, smooth muscle relaxation, immune regulation, and neuroprotection. It plays a crucial role in gastrointestinal, pulmonary, and central nervous system signaling.
In research models, VIP has shown promise in areas such as inflammatory and autoimmune disease, lung function, and gut-brain axis modulation.
Product Details:
Peptide: VIP (Vasoactive Intestinal Peptide)
Purity: >98%
Form: Lyophilized powder
Quantity: 10mg per vial
Vial Size: 3ml sterile glass vial
Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.
Grade: For research purposes only. Not for human consumption, therapeutic, or diagnostic use.
Potential Research Applications:
Neuroprotection and brain-gut axis studies
Pulmonary function and airway inflammation models
Immune system modulation and anti-inflammatory research
Gastrointestinal motility and secretory regulation
For laboratory research only. This product is not intended to diagnose, treat, cure, or prevent any disease
VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.
VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.
- Peptide Name: Vasoactive Intestinal Peptide (VIP)
- Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
- Length: 28 amino acids
- Molecular Weight: ~3,327 Da
- Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
- Purity: ≥98% (HPLC verified)
- Format: Lyophilized powder, 10mg vial
Use: For laboratory research only, not for clinical or diagnostic use
5 reviews for VIP
1. Neuroimmune Signaling and Inflammatory Regulation
VIP is used to study cytokine modulation in immune cells including T lymphocytes, macrophages, and dendritic cells. It is involved in downregulating pro-inflammatory mediators (e.g., TNF-α, IL-6) and upregulating anti-inflammatory cytokines like IL-10 in in-vitro and animal models.
2. Vascular and Smooth Muscle Physiology
Through VPAC1/VPAC2 activation, VIP induces relaxation in smooth muscle tissues such as airway, vascular, and gastrointestinal smooth muscle. These properties are often evaluated in cardiovascular or pulmonary research for assessing vasodilatory and bronchodilatory mechanisms.
3. Epithelial Barrier Integrity
VIP has been studied in gut and respiratory epithelial models where it enhances tight-junction protein expression, aiding in barrier maintenance and regulating permeability. This is relevant in preclinical studies on inflammatory bowel disease (IBD) and respiratory epithelial dysfunction.
4. Neuroprotective and Synaptic Maintenance Studies
VIP has been shown to support neurotrophic factor expression and synaptic homeostasis. It is used in neurodegenerative models and CNS-focused research to evaluate neuroplasticity, synapse maintenance, and neuron-glia signaling.
5. Anti-Fibrotic Pathway Exploration
Preclinical studies indicate that VIP downregulates fibrotic markers in lung and cardiac models, making it useful in research investigating peptide-regulated fibrotic and remodeling processes in chronic disease contexts.
Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.
Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.
Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.
Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.
Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.
Storage & Handling
All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.
- On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
- Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
- After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.
Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.
Peak Lab Peptides maintains quality-control processes and routinely performs third-party testing to support purity and identity verification. COAs are available upon request for applicable batches. Documentation may vary depending on production timelines.
We aim to make batch-level documentation available whenever possible. Our goal is to expand COA access across the full catalog as production capacity grows.
All products are for laboratory research use only and are not intended for human consumption.
Related Products
CJC-1295 No DAC
CJC-1295 No DAC
CJC-1295 No DAC – 5mg (Lyophilized Peptide) – For Research Use Only
CJC-1295 No DAC is a synthetic analog of Growth Hormone-Releasing Hormone (GHRH) designed for research on stimulating natural growth hormone (GH) release in a pulsatile manner. The “No DAC” (Drug Affinity Complex) version has a shorter half-life, allowing it to mimic the body’s natural GH secretion rhythm.
CJC-1295 No DAC is commonly studied in models focused on muscle growth, fat metabolism, anti-aging, and recovery when used alone or stacked with other GH secretagogues like Ipamorelin.
Product Details:
-
Peptide: CJC-1295 No DAC
-
Purity: >98%
-
Form: Lyophilized powder
-
Quantity: 5mg per vial
-
Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.
-
Grade: For research purposes only. Not for human use, medical, or diagnostic applications.
Potential Research Applications:
-
Growth hormone release studies
-
Muscle growth and recovery models
-
Anti-aging and longevity research
-
Fat metabolism and body composition investigations
Timothy –
Consistent quality keeps me coming back.
Jonathan –
No complaints so far—every order has gone smoothly.
Melissa –
A great balance between price, quality, and service.
Benjamin –
Delivery timelines have always been accurate and dependable.
Rebecca –
The store has earned my trust through consistency.